Lineage for d1bxsc_ (1bxs C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140678Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species)
  7. 2140918Species Sheep (Ovis aries) [TaxId:9940] [53727] (3 PDB entries)
  8. 2140923Domain d1bxsc_: 1bxs C: [35359]
    complexed with nad

Details for d1bxsc_

PDB Entry: 1bxs (more details), 2.35 Å

PDB Description: sheep liver class 1 aldehyde dehydrogenase with nad bound
PDB Compounds: (C:) aldehyde dehydrogenase

SCOPe Domain Sequences for d1bxsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxsc_ c.82.1.1 (C:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]}
dvpapltnlqfkytkifinnewhssvsgkkfpvfnpateeklceveegdkedvdkavkaa
rqafqigspwrtmdasergrllnkladlierdrlllatmeamnggklfsnaylmdlggci
ktlrycagwadkiqgrtipmdgnfftytrsepvgvcgqiipwnfpllmflwkigpalscg
ntvvvkpaeqtpltalhmgslikeagfppgvvnivpgygptagaaisshmdvdkvaftgs
tevgklikeaagksnlkrvslelggkspcivfadadldnavefahqgvfyhqgqcciaas
rlfveesiydefvrrsverakkyvlgnpltpgvsqgpqidkeqyekildliesgkkegak
lecgggpwgnkgyfiqptvfsdvtddmriakeeifgpvqqimkfkslddvikranntfyg
lsagiftndidkaitvssalqsgtvwvncysvvsaqcpfggfkmsgngrelgeygfheyt
evktvtikisqkns

SCOPe Domain Coordinates for d1bxsc_:

Click to download the PDB-style file with coordinates for d1bxsc_.
(The format of our PDB-style files is described here.)

Timeline for d1bxsc_: