SCOPe 2.08: Domain d5xrub_: 5xru B:

Lineage for d5xrub_ (5xru B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (15 species)
   not a true protein

7. Species Black rockcod (Notothenia coriiceps) [TaxId:8208] [353563] (3 PDB entries)

8. Domain d5xrub_: 5xru B: [353581]
   automated match to d3adka_
   complexed with ap5, so4

Details for d5xrub_

PDB Entry: 5xru, 1.9 Å

PDB Description: crystal structure of notothenia coriiceps adenylate kinase variant

PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d5xrub_:

Sequence; same for both SEQRES and ATOM records:

>d5xrub_ c.37.1.1 (B:) automated matches {Black rockcod (Notothenia coriiceps) [TaxId: 8208]}
akiifvvggpgsgkgtqcekivakygythlssgdllraevssgsergkqlqaimqkgelv
pldtvldmikdamiakadvskgylidgyprevkqgeefekkigkpclllyidakgetmvk
rlmkrgetsgraddneetikkrldlyykatepviafyegrgivrkidselpvdevfkqvs
taidal

Timeline for d5xrub_:

• d5xrub_ first appeared in SCOPe 2.07