SCOPe 2.07: Domain d5yczb_: 5ycz B:

Lineage for d5yczb_ (5ycz B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.0: automated matches [191368] (1 protein)
   not a true family

6. Protein automated matches [190445] (10 species)
   not a true protein

7. Species Alocasia macrorrhizos [TaxId:4456] [353546] (2 PDB entries)

8. Domain d5yczb_: 5ycz B: [353575]
   automated match to d5dvha_

Details for d5yczb_

PDB Entry: 5ycz, 2.5 Å

PDB Description: crystal structure of alocasin, protease inhibitor from giant taro (arum macrorrhizon)

PDB Compounds: (B:) Trypsin/chymotrypsin inhibitor

SCOPe Domain Sequences for d5yczb_:

Sequence, based on SEQRES records:

>d5yczb_ b.42.4.0 (B:) automated matches {Alocasia macrorrhizos [TaxId: 4456]}
tnpvldvdgnelqrgqlyyatsvmrpgggltlaapkgscplnvaqapfdeysgrplaffp
enadddtvqegstlyimfpeptrcpqstvwtfdreagfvttggttskaigphnsrfairk
agdassqprdyqievcpcstgverpscrmgclgtlglaeggknvllninnesphtirfvk
v

Sequence, based on observed residues (ATOM records):

>d5yczb_ b.42.4.0 (B:) automated matches {Alocasia macrorrhizos [TaxId: 4456]}
tnpvldvdgnelqrgqlyyatsvmrpgggltlaapkgscplnvaqapfsgrplaffpena
dddtvqegstlyimfpeptrcpqstvwtfdreagfvttggttskaigphnsrfairkagd
dyqievcpcstgverpscrmgclgtlglaeggknvllninnesphtirfvkv

Timeline for d5yczb_:

• d5yczb_ is new in SCOPe 2.07-stable
  
• d5yczb_ appears in the current release, SCOPe 2.08