SCOPe 2.08: Domain d5xoia_: 5xoi A:

Lineage for d5xoia_ (5xoi A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.0: automated matches [191672] (1 protein)
   not a true family

6. Protein automated matches [191281] (21 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [353567] (2 PDB entries)

8. Domain d5xoia_: 5xoi A: [353573]
   automated match to d3khbb_
   complexed with mn, sin

Details for d5xoia_

PDB Entry: 5xoi, 1.8 Å

PDB Description: the structure of osalkbh1

PDB Compounds: (A:) Oxidoreductase, 2OG-Fe oxygenase family protein, putative, expressed

SCOPe Domain Sequences for d5xoia_:

Sequence; same for both SEQRES and ATOM records:

>d5xoia_ b.82.2.0 (A:) automated matches {Oryza sativa [TaxId: 39947]}
plqylrpgmvllkkflkhddqvdiirrcqklgigsggfytpgyrdggklslqmmclgknw
dpnsrsygdtrpfdgaqppsipevfskivkdaiqasneflrqkarpandveelpplspdi
clvnfytssgklglhqdkdetkpslhkglpvvsfslgdtaeflygdvndvdkaskvdles
gdvlifggksrlifhgvsrikpktapnwltdeaklrpgrlnltfrqh

Timeline for d5xoia_:

• d5xoia_ first appeared in SCOPe 2.07