Lineage for d5xrwc_ (5xrw C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.139: Surface presentation of antigens (SPOA) [101800] (1 superfamily)
    segment-swapped dimer forming two identical conjoint barrels (n=6, S=10) topologically similar to the FMN-binding split barrel
  4. Superfamily b.139.1: Surface presentation of antigens (SPOA) [101801] (2 families) (S)
    automatically mapped to Pfam PF01052
  5. Family b.139.1.0: automated matches [353558] (1 protein)
    not a true family
  6. Protein automated matches [353559] (1 species)
    not a true protein
  7. Species Helicobacter pylori [TaxId:85962] [353560] (1 PDB entry)
  8. Domain d5xrwc_: 5xrw C: [353561]
    automated match to d1o6ab_

Details for d5xrwc_

PDB Entry: 5xrw (more details), 2.5 Å

PDB Description: crystal structure of flagellar motor switch complex from h. pylori
PDB Compounds: (C:) FliY

SCOPe Domain Sequences for d5xrwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xrwc_ b.139.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 85962]}
lgslnvkvrigqkkmilkdvvsmdigsvveldqlvndpleilvddkviakgevvivdgnf
giqitdigtkkerleqlk

SCOPe Domain Coordinates for d5xrwc_ are not available.

Timeline for d5xrwc_:

Domains from other chains:
(mouse over for more information)
d5xrwd_