Class a: All alpha proteins [46456] (290 folds) |
Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
Superfamily a.64.1: Saposin [47862] (5 families) Lipid-binding can promote conformational changes and oligomerisation in some members |
Family a.64.1.1: NKL-like [47863] (4 proteins) |
Protein automated matches [274940] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [353530] (1 PDB entry) |
Domain d5u85a_: 5u85 A: [353550] automated match to d3bqqa_ |
PDB Entry: 5u85 (more details), 1.65 Å
SCOPe Domain Sequences for d5u85a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u85a_ a.64.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gfcevckklvlylehnleknstkeeilaalekgcsflpdpyqkqcddfvaeyepllleil vevmdpgfvcskigvcps
Timeline for d5u85a_: