Lineage for d6c3ya2 (6c3y A:146-345)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977656Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2977657Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2977743Family d.134.1.0: automated matches [254284] (1 protein)
    not a true family
  6. 2977744Protein automated matches [254663] (3 species)
    not a true protein
  7. 2977752Species Escherichia coli [TaxId:83333] [353430] (4 PDB entries)
  8. 2977757Domain d6c3ya2: 6c3y A:146-345 [353535]
    Other proteins in same PDB: d6c3ya1, d6c3ya3
    automated match to d1aopa3
    complexed with k, po4, sf4, srm

Details for d6c3ya2

PDB Entry: 6c3y (more details), 1.54 Å

PDB Description: wild type structure of sirhp
PDB Compounds: (A:) Sulfite reductase [NADPH] hemoprotein beta-component

SCOPe Domain Sequences for d6c3ya2:

Sequence, based on SEQRES records: (download)

>d6c3ya2 d.134.1.0 (A:146-345) automated matches {Escherichia coli [TaxId: 83333]}
atandmnrnvlctsnpyesqlhaeayewakkisehllprtrayaeiwldqekvattdeep
ilgqtylprkfkttvvippqndidlhandmnfvaiaengklvgfnllvggglsiehgnkk
tyartasefgylplehtlavaeavvttqrdwgnrtdrknaktkytlervgvetfkaever
ragikfepirpyeftgrgdr

Sequence, based on observed residues (ATOM records): (download)

>d6c3ya2 d.134.1.0 (A:146-345) automated matches {Escherichia coli [TaxId: 83333]}
atandmnrnvlctsnpyesqlhaeayewakkisehllptylprkfkttvvippqndidlh
andmnfvaiaengklvgfnllvggglsiehgnkktyartasefgylplehtlavaeavvt
tqrdwgnrtdrknaktkytlervgvetfkaeverragikfepirpyeftgrgdr

SCOPe Domain Coordinates for d6c3ya2:

Click to download the PDB-style file with coordinates for d6c3ya2.
(The format of our PDB-style files is described here.)

Timeline for d6c3ya2: