SCOPe 2.08: Domain d5u85b_: 5u85 B:

Lineage for d5u85b_ (5u85 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.64: Saposin-like [47861] (2 superfamilies)
   5 helices; folded leaf, closed

4. Superfamily a.64.1: Saposin [47862] (5 families)
   Lipid-binding can promote conformational changes and oligomerisation in some members

5. Family a.64.1.1: NKL-like [47863] (4 proteins)

6. Protein automated matches [274940] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [353530] (1 PDB entry)

8. Domain d5u85b_: 5u85 B: [353531]
   automated match to d3bqqa_

Details for d5u85b_

PDB Entry: 5u85, 1.65 Å

PDB Description: murine saposin-d (sapd), open conformation

PDB Compounds: (B:) Saposin-D

SCOPe Domain Sequences for d5u85b_:

Sequence; same for both SEQRES and ATOM records:

>d5u85b_ a.64.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gfcevckklvlylehnleknstkeeilaalekgcsflpdpyqkqcddfvaeyepllleil
vevmdpgfvcskigvcp

Timeline for d5u85b_:

• d5u85b_ first appeared in SCOPe 2.07