Lineage for d5u85b_ (5u85 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716976Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2716977Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 2716978Family a.64.1.1: NKL-like [47863] (4 proteins)
  6. 2717007Protein automated matches [274940] (2 species)
    not a true protein
  7. 2717011Species Mouse (Mus musculus) [TaxId:10090] [353530] (1 PDB entry)
  8. 2717013Domain d5u85b_: 5u85 B: [353531]
    automated match to d3bqqa_

Details for d5u85b_

PDB Entry: 5u85 (more details), 1.65 Å

PDB Description: murine saposin-d (sapd), open conformation
PDB Compounds: (B:) Saposin-D

SCOPe Domain Sequences for d5u85b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u85b_ a.64.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gfcevckklvlylehnleknstkeeilaalekgcsflpdpyqkqcddfvaeyepllleil
vevmdpgfvcskigvcp

SCOPe Domain Coordinates for d5u85b_:

Click to download the PDB-style file with coordinates for d5u85b_.
(The format of our PDB-style files is described here.)

Timeline for d5u85b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5u85a_