Lineage for d5u6wa_ (5u6w A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. Protein automated matches [190847] (97 species)
    not a true protein
  7. Species Rhodopseudomonas palustris [TaxId:316058] [193594] (33 PDB entries)
  8. Domain d5u6wa_: 5u6w A: [353527]
    automated match to d4egoa_
    complexed with 81p, cl, hem

Details for d5u6wa_

PDB Entry: 5u6w (more details), 2.64 Å

PDB Description: the crystal structure of 4-methylaminobenzoate-bound cyp199a4
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d5u6wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u6wa_ a.104.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
rkvaaididgpvkrrfnntlrgleslpvkltpa

SCOPe Domain Coordinates for d5u6wa_ are not available.

Timeline for d5u6wa_: