Lineage for d5nrvd_ (5nrv D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. Protein DNA methyltransferase DNMT3B [69251] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [188834] (10 PDB entries)
  8. Domain d5nrvd_: 5nrv D: [353491]
    automated match to d3qkjb_
    complexed with 96k, so4

Details for d5nrvd_

PDB Entry: 5nrv (more details), 2.08 Å

PDB Description: human dnmt3b pwwp domain in complex with 6-dipropylamino-1-hexanol
PDB Compounds: (D:) DNA (cytosine-5)-methyltransferase 3B

SCOPe Domain Sequences for d5nrvd_:

Sequence, based on SEQRES records: (download)

>d5nrvd_ b.34.9.2 (D:) DNA methyltransferase DNMT3B {Human (Homo sapiens) [TaxId: 9606]}
eyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsad
klvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsledqlkpmlew
ahggfkptgieglkp

Sequence, based on observed residues (ATOM records): (download)

>d5nrvd_ b.34.9.2 (D:) DNA methyltransferase DNMT3B {Human (Homo sapiens) [TaxId: 9606]}
eyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsad
klvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpdsledqlkpmlewahgg
fkptgieglkp

SCOPe Domain Coordinates for d5nrvd_ are not available.

Timeline for d5nrvd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5nrva_