Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (81 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187871] (32 PDB entries) |
Domain d6chhd_: 6chh D: [353490] Other proteins in same PDB: d6chha2, d6chhb2 automated match to d3roda_ complexed with edo, f0p |
PDB Entry: 6chh (more details), 2.3 Å
SCOPe Domain Sequences for d6chhd_:
Sequence, based on SEQRES records: (download)
>d6chhd_ c.66.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nprdylekyykfgsrhsaesqilkhllknlfkifcldgvkgdllidigsgptiyqllsac esfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrvkgpekeeklrqav kqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrnlgsllkpggflvi mdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsysstmanneglfsl varkls
>d6chhd_ c.66.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nprdylekyykrhsaesqilkhllknlfkifcldgvkgdllidigsgptiyqllsacesf keivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrvkgpekeeklrqavkqv lkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrnlgsllkpggflvimda lkssyymigeqkfsslplgreaveaavkeagytiewfevisqsysstmanneglfslvar kls
Timeline for d6chhd_: