Lineage for d6chhd_ (6chh D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468838Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2468839Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2470351Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2470352Protein automated matches [190689] (81 species)
    not a true protein
  7. 2470507Species Human (Homo sapiens) [TaxId:9606] [187871] (32 PDB entries)
  8. 3053428Domain d6chhd_: 6chh D: [353490]
    Other proteins in same PDB: d6chha2, d6chhb2
    automated match to d3roda_
    complexed with edo, f0p

Details for d6chhd_

PDB Entry: 6chh (more details), 2.3 Å

PDB Description: structure of human nnmt in complex with bisubstrate inhibitor ms2756
PDB Compounds: (D:) Nicotinamide N-methyltransferase

SCOPe Domain Sequences for d6chhd_:

Sequence, based on SEQRES records: (download)

>d6chhd_ c.66.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nprdylekyykfgsrhsaesqilkhllknlfkifcldgvkgdllidigsgptiyqllsac
esfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrvkgpekeeklrqav
kqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrnlgsllkpggflvi
mdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsysstmanneglfsl
varkls

Sequence, based on observed residues (ATOM records): (download)

>d6chhd_ c.66.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nprdylekyykrhsaesqilkhllknlfkifcldgvkgdllidigsgptiyqllsacesf
keivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrvkgpekeeklrqavkqv
lkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrnlgsllkpggflvimda
lkssyymigeqkfsslplgreaveaavkeagytiewfevisqsysstmanneglfslvar
kls

SCOPe Domain Coordinates for d6chhd_:

Click to download the PDB-style file with coordinates for d6chhd_.
(The format of our PDB-style files is described here.)

Timeline for d6chhd_:

  • d6chhd_ is new in SCOPe 2.07-stable