Class g: Small proteins [56992] (100 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (3 families) |
Family g.14.1.0: automated matches [254254] (1 protein) not a true family |
Protein automated matches [254580] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255350] (15 PDB entries) |
Domain d6bano_: 6ban O: [353479] Other proteins in same PDB: d6bana1, d6bana2, d6banb_, d6banc1, d6banc2, d6band_, d6bane1, d6bane2, d6banf_, d6bang1, d6bang2, d6banh_ automated match to d2l0sa_ |
PDB Entry: 6ban (more details), 1.95 Å
SCOPe Domain Sequences for d6bano_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bano_ g.14.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqke apwcftldenfksdlcdipac
Timeline for d6bano_: