Lineage for d6bano_ (6ban O:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033486Family g.14.1.0: automated matches [254254] (1 protein)
    not a true family
  6. 3033487Protein automated matches [254580] (2 species)
    not a true protein
  7. 3033488Species Human (Homo sapiens) [TaxId:9606] [255350] (15 PDB entries)
  8. 3033502Domain d6bano_: 6ban O: [353479]
    Other proteins in same PDB: d6bana1, d6bana2, d6banb_, d6banc1, d6banc2, d6band_, d6bane1, d6bane2, d6banf_, d6bang1, d6bang2, d6banh_
    automated match to d2l0sa_

Details for d6bano_

PDB Entry: 6ban (more details), 1.95 Å

PDB Description: potent and selective antitumor activity of a t-cell engaging bispecific antibody targeting a membrane-proximal epitope of ror1
PDB Compounds: (O:) Inactive tyrosine-protein kinase transmembrane receptor ROR1

SCOPe Domain Sequences for d6bano_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bano_ g.14.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqke
apwcftldenfksdlcdipac

SCOPe Domain Coordinates for d6bano_:

Click to download the PDB-style file with coordinates for d6bano_.
(The format of our PDB-style files is described here.)

Timeline for d6bano_: