Lineage for d6gmba_ (6gmb A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414849Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2415386Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2415387Protein automated matches [190048] (31 species)
    not a true protein
  7. 2415456Species Human (Homo sapiens) [TaxId:9606] [189110] (16 PDB entries)
  8. 3053416Domain d6gmba_: 6gmb A: [353478]
    automated match to d2rdua_
    complexed with edo, fmn, goa, pg4

Details for d6gmba_

PDB Entry: 6gmb (more details), 1.35 Å

PDB Description: structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
PDB Compounds: (A:) hydroxyacid oxidase 1

SCOPe Domain Sequences for d6gmba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gmba_ c.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlprlicindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaet
dlstsvlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevae
agpealrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklppq
lrmknfetstlsfspeenfgddsglaayvakaidpsiswedikwlrrltslpivakgilr
gddareavkhglngilvsnhgarqldgvpatidvlpeiveavegkvevfldggvrkgtdv
lkalalgakavfvgrpivwglafqgekgvqdvleilkeefrlamalsgcqnvkvidktlv
rk

SCOPe Domain Coordinates for d6gmba_:

Click to download the PDB-style file with coordinates for d6gmba_.
(The format of our PDB-style files is described here.)

Timeline for d6gmba_:

  • d6gmba_ is new in SCOPe 2.07-stable