Lineage for d1a4zc_ (1a4z C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140678Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species)
  7. 2140688Species Cow (Bos taurus), mitochondrial [TaxId:9913] [53725] (2 PDB entries)
  8. 2140695Domain d1a4zc_: 1a4z C: [35347]
    complexed with nad, sm

Details for d1a4zc_

PDB Entry: 1a4z (more details), 2.75 Å

PDB Description: aldehyde dehydrogenase from bovine mitochondria complex with nad (reduced) and samarium (iii)
PDB Compounds: (C:) aldehyde dehydrogenase

SCOPe Domain Sequences for d1a4zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4zc_ c.82.1.1 (C:) Aldehyde reductase (dehydrogenase), ALDH {Cow (Bos taurus), mitochondrial [TaxId: 9913]}
vptpnqqpevlynqifinnewhdavskktfptvnpstgdvichvaegdkadvdravkaar
aafqlgspwrrmdasergrllnrladlierdrtylaaletldngkpyiisylvdldmvlk
clryyagwadkyhgktipidgdyfsytrhepvgvcgqiipwnfpllmqawklgpalatgn
vvvmkvaeqtpltalyvanlikeagfppgvvnvipgfgptagaaiashedvdkvaftgst
evghliqvaagksnlkrvtleiggkspniimsdadmdwaveqahfalffnqgqcccagsr
tfvqediyaefversvaraksrvvgnpfdsrteqgpqvdetqfkkvlgyiksgkeeglkl
lcgggaaadrgyfiqptvfgdlqdgmtiakeeifgpvmqilkfksmeevvgrannskygl
aaavftkdldkanylsqalqagtvwvncydvfgaqspfggyklsgsgrelgeyglqayte
vktvtvrvpqkns

SCOPe Domain Coordinates for d1a4zc_:

Click to download the PDB-style file with coordinates for d1a4zc_.
(The format of our PDB-style files is described here.)

Timeline for d1a4zc_: