Lineage for d6g16c_ (6g16 C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. Family b.69.4.1: WD40-repeat [50979] (17 proteins)
  6. Protein automated matches [190346] (4 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [311290] (6 PDB entries)
  8. Domain d6g16c_: 6g16 C: [353461]
    automated match to d3c99a_

Details for d6g16c_

PDB Entry: 6g16 (more details), 2.8 Å

PDB Description: structure of the human rbbp4:mta1(464-546) complex showing loop exchange
PDB Compounds: (C:) Histone-binding protein RBBP4

SCOPe Domain Sequences for d6g16c_:

Sequence, based on SEQRES records: (download)

>d6g16c_ b.69.4.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
daveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtrpegkdfsihrlvlg
thtsdeqnhlviasvqlpnddaqfdashydsekgefggfgsvsgkieieikinhegevnr
arympqnpciiatktpssdvlvfdytkhpskpdpsgecnpdlrlrghqkegyglswnpnl
sghllsasddhticlwdisavpkegkvvdaktiftghtavvedvswhllheslfgsvadd
qklmiwdtrsnntskpshsvdahtaevnclsfnpysefilatgsadktvalwdlrnlklk
lhsfeshkdeifqvqwsphnetilassgtdrrlnvwdlskigeeqspedaedgppellfi
hgghtakisdfswnpnepwvicsvsednimqvwqmaeniynd

Sequence, based on observed residues (ATOM records): (download)

>d6g16c_ b.69.4.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
daveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtrpegkdfsihrlvlg
thtsdeqnhlviasvqlpndgefggfgsvsgkieieikinhegevnrarympqnpciiat
ktpssdvlvfdytkhpskpdpsgecnpdlrlrghqkegyglswnpnlsghllsasddhti
clwdisavpkegkvvdaktiftghtavvedvswhllheslfgsvaddqklmiwdtrsnnt
skpshsvdahtaevnclsfnpysefilatgsadktvalwdlrnlklklhsfeshkdeifq
vqwsphnetilassgtdrrlnvwdlskigeeqspedaedgppellfihgghtakisdfsw
npnepwvicsvsednimqvwqmaeniynd

SCOPe Domain Coordinates for d6g16c_ are not available.

Timeline for d6g16c_:

Domains from other chains:
(mouse over for more information)
d6g16a_, d6g16e_, d6g16g_