Lineage for d6ba5e1 (6ba5 E:3-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754748Domain d6ba5e1: 6ba5 E:3-111 [353456]
    Other proteins in same PDB: d6ba5a2, d6ba5b_, d6ba5c2, d6ba5d_, d6ba5e2, d6ba5f_, d6ba5g2, d6ba5h_, d6ba5m_, d6ba5n_, d6ba5o_, d6ba5p_
    automated match to d5kvel_

Details for d6ba5e1

PDB Entry: 6ba5 (more details), 1.62 Å

PDB Description: potent and selective antitumor activity of a t-cell engaging bispecific antibody targeting a membrane-proximal epitope of ror1
PDB Compounds: (E:) Variable domain of Light Chain, antibody R11

SCOPe Domain Sequences for d6ba5e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ba5e1 b.1.1.0 (E:3-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlasgvpsr
fsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk

SCOPe Domain Coordinates for d6ba5e1:

Click to download the PDB-style file with coordinates for d6ba5e1.
(The format of our PDB-style files is described here.)

Timeline for d6ba5e1:

  • d6ba5e1 first appeared in SCOPe 2.07, called d6ba5e_