Lineage for d6dk4a_ (6dk4 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. Protein automated matches [190154] (91 species)
    not a true protein
  7. Species Campylobacter jejuni [TaxId:197] [352445] (2 PDB entries)
  8. Domain d6dk4a_: 6dk4 A: [353455]
    automated match to d5fd5c_
    complexed with mn, mpd, zn

Details for d6dk4a_

PDB Entry: 6dk4 (more details), 2.71 Å

PDB Description: crystal structure of campylobacter jejuni peroxide stress regulator
PDB Compounds: (A:) ferric uptake regulation protein

SCOPe Domain Sequences for d6dk4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dk4a_ a.4.5.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
mellqmlkkhelkatpqrlcvlkilkrhehpnidelyieikkeypsislatvyknlntlq
eqglvveinvlnqktcydiyeeehihvvctkcggiedlsfkdaklyeyqehlekkignlv
nhlsvcayvdnckkc

SCOPe Domain Coordinates for d6dk4a_ are not available.

Timeline for d6dk4a_:

Domains from other chains:
(mouse over for more information)
d6dk4b_