Lineage for d6chha1 (6chh A:1-262)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468838Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2468839Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2470351Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2470352Protein automated matches [190689] (81 species)
    not a true protein
  7. 2470507Species Human (Homo sapiens) [TaxId:9606] [187871] (32 PDB entries)
  8. 3053382Domain d6chha1: 6chh A:1-262 [353444]
    Other proteins in same PDB: d6chha2, d6chhb2
    automated match to d3roda_
    complexed with edo, f0p

Details for d6chha1

PDB Entry: 6chh (more details), 2.3 Å

PDB Description: structure of human nnmt in complex with bisubstrate inhibitor ms2756
PDB Compounds: (A:) Nicotinamide N-methyltransferase

SCOPe Domain Sequences for d6chha1:

Sequence, based on SEQRES records: (download)

>d6chha1 c.66.1.0 (A:1-262) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mesgftskdtylshfnprdylekyykfgsrhsaesqilkhllknlfkifcldgvkgdlli
digsgptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegn
rvkgpekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycral
rnlgsllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisq
sysstmanneglfslvarklsr

Sequence, based on observed residues (ATOM records): (download)

>d6chha1 c.66.1.0 (A:1-262) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mesgftskdtylshfnprdylekyyksrhsaesqilkhllknlfkifcldgvkgdllidi
gsgptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrv
kgpekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrn
lgsllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsy
sstmanneglfslvarklsr

SCOPe Domain Coordinates for d6chha1:

Click to download the PDB-style file with coordinates for d6chha1.
(The format of our PDB-style files is described here.)

Timeline for d6chha1:

  • d6chha1 is new in SCOPe 2.07-stable