Lineage for d6chhb1 (6chh B:1-262)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502371Species Human (Homo sapiens) [TaxId:9606] [187871] (32 PDB entries)
  8. 2502433Domain d6chhb1: 6chh B:1-262 [353435]
    Other proteins in same PDB: d6chha2, d6chhb2
    automated match to d3roda_
    complexed with edo, f0p

Details for d6chhb1

PDB Entry: 6chh (more details), 2.3 Å

PDB Description: structure of human nnmt in complex with bisubstrate inhibitor ms2756
PDB Compounds: (B:) Nicotinamide N-methyltransferase

SCOPe Domain Sequences for d6chhb1:

Sequence, based on SEQRES records: (download)

>d6chhb1 c.66.1.0 (B:1-262) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mesgftskdtylshfnprdylekyykfgsrhsaesqilkhllknlfkifcldgvkgdlli
digsgptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegn
rvkgpekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycral
rnlgsllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisq
sysstmanneglfslvarklsr

Sequence, based on observed residues (ATOM records): (download)

>d6chhb1 c.66.1.0 (B:1-262) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mesgftskdtylshfnprdylekyykhsaesqilkhllknlfkifcldgvkgdllidigs
gptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrvkg
pekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrnlg
sllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsyss
tmanneglfslvarklsr

SCOPe Domain Coordinates for d6chhb1:

Click to download the PDB-style file with coordinates for d6chhb1.
(The format of our PDB-style files is described here.)

Timeline for d6chhb1: