Lineage for d6chhb1 (6chh B:1-262)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. Protein automated matches [190689] (86 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187871] (35 PDB entries)
  8. Domain d6chhb1: 6chh B:1-262 [353435]
    Other proteins in same PDB: d6chha2, d6chhb2
    automated match to d3roda_
    complexed with edo, f0p

Details for d6chhb1

PDB Entry: 6chh (more details), 2.3 Å

PDB Description: structure of human nnmt in complex with bisubstrate inhibitor ms2756
PDB Compounds: (B:) Nicotinamide N-methyltransferase

SCOPe Domain Sequences for d6chhb1:

Sequence, based on SEQRES records: (download)

>d6chhb1 c.66.1.0 (B:1-262) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mesgftskdtylshfnprdylekyykfgsrhsaesqilkhllknlfkifcldgvkgdlli
digsgptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegn
rvkgpekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycral
rnlgsllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisq
sysstmanneglfslvarklsr

Sequence, based on observed residues (ATOM records): (download)

>d6chhb1 c.66.1.0 (B:1-262) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mesgftskdtylshfnprdylekyykhsaesqilkhllknlfkifcldgvkgdllidigs
gptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrvkg
pekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrnlg
sllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsyss
tmanneglfslvarklsr

SCOPe Domain Coordinates for d6chhb1 are not available.

Timeline for d6chhb1:

Domains from same chain:
(mouse over for more information)
d6chhb2
Domains from other chains:
(mouse over for more information)
d6chha1, d6chha2, d6chhc_, d6chhd_