Lineage for d6c3za3 (6c3z A:346-425)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. Family d.58.36.0: automated matches [254283] (1 protein)
    not a true family
  6. Protein automated matches [254662] (3 species)
    not a true protein
  7. Species Escherichia coli [TaxId:83333] [353425] (4 PDB entries)
  8. Domain d6c3za3: 6c3z A:346-425 [353432]
    Other proteins in same PDB: d6c3za2, d6c3za4
    automated match to d1aopa2
    complexed with k, po4, sf4, srm

Details for d6c3za3

PDB Entry: 6c3z (more details), 1.6800000000000002 Å

PDB Description: t477a sirhp
PDB Compounds: (A:) Sulfite reductase [NADPH] hemoprotein beta-component

SCOPe Domain Sequences for d6c3za3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c3za3 d.58.36.0 (A:346-425) automated matches {Escherichia coli [TaxId: 83333]}
igwvkgiddnwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpe
sekakiekiakesglmnavt

SCOPe Domain Coordinates for d6c3za3 are not available.

Timeline for d6c3za3:

Domains from same chain:
(mouse over for more information)
d6c3za1, d6c3za2, d6c3za4