SCOPe 2.08: Domain d6aq1a1: 6aq1 A:1-133

Lineage for d6aq1a1 (6aq1 A:1-133)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50849] (22 PDB entries)

8. Domain d6aq1a1: 6aq1 A:1-133 [353416]
   Other proteins in same PDB: d6aq1a2, d6aq1b2
   automated match to d4tkba_
   complexed with plm, so4

Details for d6aq1a1

PDB Entry: 6aq1, 1.4 Å

PDB Description: the crystal structure of human fabp3

PDB Compounds: (A:) Fatty acid-binding protein, heart

SCOPe Domain Sequences for d6aq1a1:

Sequence; same for both SEQRES and ATOM records:

>d6aq1a1 b.60.1.2 (A:1-133) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]}
mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
gtavctrtyekea

Timeline for d6aq1a1:

• d6aq1a1 first appeared in SCOPe 2.07