Lineage for d1bi9d_ (1bi9 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140678Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species)
  7. 2140913Species Norway rat (Rattus norvegicus), retinal type II [TaxId:10116] [53724] (1 PDB entry)
  8. 2140917Domain d1bi9d_: 1bi9 D: [35340]
    complexed with cl, nad

Details for d1bi9d_

PDB Entry: 1bi9 (more details), 2.7 Å

PDB Description: retinal dehydrogenase type two with nad bound
PDB Compounds: (D:) retinal dehydrogenase type II

SCOPe Domain Sequences for d1bi9d_:

Sequence, based on SEQRES records: (download)

>d1bi9d_ c.82.1.1 (D:) Aldehyde reductase (dehydrogenase), ALDH {Norway rat (Rattus norvegicus), retinal type II [TaxId: 10116]}
maslqllpsptpnleikytkifinnewqnsesgrvfpvcnpatgeqvcevqeadkvdidk
avqaarlafslgsvwrrmdasergrlldkladlverdratlatmeslnggkpflqafyid
lqgviktlryyagwadkihgmtipvdgdyftftrhepigvcgqiipwnfpllmftwkiap
alccgntvvikpaeqtplsalymgalikeagfppgvvnilpgygptagaaiashigidki
aftgstevgkliqeaagrsnlkrvtlelggkspniifadadldyaveqahqgvffnqgqc
ctagsrifveesiyeefvkrsverakrrivgspfdptteqgpqidkkqynkileliqsgv
aegaklecggkglgrkgffieptvfsnvtddmriakeeifgpvqeilrfktmdevieran
nsdfglvaavftndinkalmvssamqagtvwincynalnaqspfggfkmsgngremgefg
lreysevktvtvkipqkns

Sequence, based on observed residues (ATOM records): (download)

>d1bi9d_ c.82.1.1 (D:) Aldehyde reductase (dehydrogenase), ALDH {Norway rat (Rattus norvegicus), retinal type II [TaxId: 10116]}
maslqllpsptpnleikytkifinnewqnsesgrvfpvcnpatgeqvcevqeadkvdidk
avqaarlafslgsvwrrmdasergrlldkladlverdratlatmeslnggkpflqafyid
lqgviktlryyagwadkihgmtipvdgdyftftrhepigvcgqiipwnfpllmftwkiap
alccgntvvikpaeqtplsalymgalikeagfppgvvnilpgygptagaaiashigidki
aftgstevgkliqeaagrsnlkrvtlelggkspniifadadldyaveqahqgvffnqgqc
ctagsrifveesiyeefvkrsverakrrivgspfdptteqgpqidkkqynkileliqsgv
aegaklecggkglgrkgffieptvfsnvtddmriakeeifgpvqeilrfktmdevieran
nsdfglvaavftndinkalmvssamqagtvwincynalngefglreysevktvtvkipqk
ns

SCOPe Domain Coordinates for d1bi9d_:

Click to download the PDB-style file with coordinates for d1bi9d_.
(The format of our PDB-style files is described here.)

Timeline for d1bi9d_: