Lineage for d5z78a1 (5z78 A:6-204)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. Protein automated matches [191036] (17 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [316181] (2 PDB entries)
  8. Domain d5z78a1: 5z78 A:6-204 [353396]
    Other proteins in same PDB: d5z78a2, d5z78c1, d5z78c2, d5z78c3
    automated match to d3kvha_
    protein/DNA complex

Details for d5z78a1

PDB Entry: 5z78 (more details), 1.7600000000000002 Å

PDB Description: structure of tirr/53bp1 complex
PDB Compounds: (A:) Tudor-interacting repair regulator protein

SCOPe Domain Sequences for d5z78a1:

Sequence, based on SEQRES records: (download)

>d5z78a1 d.113.1.0 (A:6-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vpelkqisreeamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpgg
fvdrrfwsledglnrvlglglgglrlteadylsshltegphrvvahlyarqltleqlhav
eisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakyqllfalkvlnmmps
eklaealasatekqkkale

Sequence, based on observed residues (ATOM records): (download)

>d5z78a1 d.113.1.0 (A:6-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vpelkqisreeamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpgg
fvdrrfwsledglnrvlglggglrlteadylsshltegphrvvahlyarqltleqlhave
isavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakyqllfalkvlnmmpse
klaealasatekqkkale

SCOPe Domain Coordinates for d5z78a1 are not available.

Timeline for d5z78a1:

Domains from same chain:
(mouse over for more information)
d5z78a2
Domains from other chains:
(mouse over for more information)
d5z78b_, d5z78c1, d5z78c2, d5z78c3