SCOPe 2.08: Domain d5ygua2: 5ygu A:131-274

Lineage for d5ygua2 (5ygu A:131-274)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins)
   automatically mapped to Pfam PF01678

6. Protein automated matches [352381] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [353391] (4 PDB entries)

8. Domain d5ygua2: 5ygu A:131-274 [353393]
   automated match to d4ijza2
   protein/RNA complex; complexed with iod, tla

Details for d5ygua2

PDB Entry: 5ygu, 2.3 Å

PDB Description: crystal structure of escherichia coli (strain k12) mrna decapping complex rpph-dapf

PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d5ygua2:

Sequence; same for both SEQRES and ATOM records:

>d5ygua2 d.21.1.1 (A:131-274) automated matches {Escherichia coli [TaxId: 83333]}
rankaektyimraaeqtilcgvvsmgnphcviqvddvdtaavetlgpvlesherfperan
igfmqvvkrehirlrvyergagetqacgsgacaavavgiqqgllaeevrvelpggrldia
wkgpghplymtgpavhvydgfihl

Timeline for d5ygua2:

• d5ygua2 first appeared in SCOPe 2.07