Lineage for d5ygua2 (5ygu A:131-274)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939535Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2939536Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2939537Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins)
    automatically mapped to Pfam PF01678
  6. 2939586Protein automated matches [352381] (2 species)
    not a true protein
  7. 2939592Species Escherichia coli [TaxId:83333] [353391] (4 PDB entries)
  8. 2939596Domain d5ygua2: 5ygu A:131-274 [353393]
    automated match to d4ijza2
    protein/RNA complex; complexed with iod, tla

Details for d5ygua2

PDB Entry: 5ygu (more details), 2.3 Å

PDB Description: crystal structure of escherichia coli (strain k12) mrna decapping complex rpph-dapf
PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d5ygua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ygua2 d.21.1.1 (A:131-274) automated matches {Escherichia coli [TaxId: 83333]}
rankaektyimraaeqtilcgvvsmgnphcviqvddvdtaavetlgpvlesherfperan
igfmqvvkrehirlrvyergagetqacgsgacaavavgiqqgllaeevrvelpggrldia
wkgpghplymtgpavhvydgfihl

SCOPe Domain Coordinates for d5ygua2:

Click to download the PDB-style file with coordinates for d5ygua2.
(The format of our PDB-style files is described here.)

Timeline for d5ygua2: