Lineage for d5z78b_ (5z78 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2578347Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2578348Protein automated matches [191036] (17 species)
    not a true protein
  7. 2578483Species Mouse (Mus musculus) [TaxId:10090] [316181] (2 PDB entries)
  8. 2578485Domain d5z78b_: 5z78 B: [353370]
    Other proteins in same PDB: d5z78a2, d5z78c1, d5z78c2, d5z78c3
    automated match to d3kvha_
    protein/DNA complex

Details for d5z78b_

PDB Entry: 5z78 (more details), 1.76 Å

PDB Description: structure of tirr/53bp1 complex
PDB Compounds: (B:) Tudor-interacting repair regulator protein

SCOPe Domain Sequences for d5z78b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z78b_ d.113.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pelkqisreeamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpggf
vdrrfwsledglnrvlglglgglrlteadylsshltegphrvvahlyarqltleqlhave
isavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakyqllfalkvlnmmpse
klaealasatekqkkal

SCOPe Domain Coordinates for d5z78b_:

Click to download the PDB-style file with coordinates for d5z78b_.
(The format of our PDB-style files is described here.)

Timeline for d5z78b_: