Lineage for d5w1ba_ (5w1b A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. Family c.67.1.2: Beta-eliminating lyases [53397] (3 proteins)
  6. Protein Tryptophan indol-lyase (tryptophanase) [53400] (2 species)
  7. Species Proteus vulgaris [TaxId:585] [53401] (3 PDB entries)
  8. Domain d5w1ba_: 5w1b A: [353366]
    automated match to d1ax4a_
    complexed with k

Details for d5w1ba_

PDB Entry: 5w1b (more details), 2 Å

PDB Description: tryptophan indole-lyase
PDB Compounds: (A:) tryptophanase

SCOPe Domain Sequences for d5w1ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w1ba_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]}
akrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdhq
waamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegka
knpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhga
dnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpky
knatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvty
gglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdckk
lvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarrv
ytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpie

SCOPe Domain Coordinates for d5w1ba_ are not available.

Timeline for d5w1ba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5w1bb_, d5w1bc_, d5w1bd_