Lineage for d5xlel_ (5xle L:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. Family e.18.1.1: Nickel-iron hydrogenase, large subunit [56763] (2 proteins)
  6. Protein automated matches [190109] (8 species)
    not a true protein
  7. Species Desulfovibrio vulgaris [TaxId:883] [186833] (12 PDB entries)
  8. Domain d5xlel_: 5xle L: [353359]
    Other proteins in same PDB: d5xles_
    automated match to d4ud6r_
    complexed with f3s, mg, mpd, nfu, sf4, trs

Details for d5xlel_

PDB Entry: 5xle (more details), 1.6900000000000002 Å

PDB Description: crystal structure of anaerobically purified and anaerobically crystallized d. vulgaris miyazaki f [nife]-hydrogenase
PDB Compounds: (L:) Periplasmic [NiFe] hydrogenase Large subunit

SCOPe Domain Sequences for d5xlel_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xlel_ e.18.1.1 (L:) automated matches {Desulfovibrio vulgaris [TaxId: 883]}
sysgpivvdpvtrieghlrievevengkvknayssstlfrgleiilkgrdprdaqhftqr
tcgvctythalastrcvdnavgvhipknatyirnlvlgaqylhdhivhfyhlhaldfvdv
taalkadpakaakvassisprkttaadlkavqdklktfvesgqlgpftnayflgghpayy
ldpetnliatahylealrlqvkaaramavfgaknphtqftvvggvtcydaltpqriaefe
alwketkafvdevyipdllvvaaaykdwtqyggtdnfitfgefpkdeydlnsrffkpgvv
fkrdfknikpfdkmqieehvrhswyegaearhpwkgqtqpkytdlhgddryswmkaprym
gepmetgplaqvliaysqghpkvkavtdavlaklgvgpealfstlgrtaargietaviae
yvgvmlqeykdniakgdnvicapwempkqaegvgfvnaprgglshwiriedgkignfqlv
vpstwtlgprcdknklspveasligtpvadakrpveilrtvhsfdpciacgvh

SCOPe Domain Coordinates for d5xlel_ are not available.

Timeline for d5xlel_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5xles_