Lineage for d5xpsa1 (5xps A:3-334)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. Protein automated matches [227126] (21 species)
    not a true protein
  7. Species Scheffersomyces stipitis [TaxId:322104] [328848] (25 PDB entries)
  8. Domain d5xpsa1: 5xps A:3-334 [353352]
    Other proteins in same PDB: d5xpsa3
    automated match to d1ay0a1
    complexed with ca, e4p, peg, tpp

Details for d5xpsa1

PDB Entry: 5xps (more details), 1.07 Å

PDB Description: crystal structure of transketolase in complex with erythrose-4- phosphate from pichia stipitis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5xpsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xpsa1 c.36.1.0 (A:3-334) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
svdqkaistirllavdavaaansghpgaplglapaahavfkkmrfnpkdtkwinrdrfvl
snghacallysmlvlygydltvedlkkfrqlgsktpghpentdvpgaevttgplgqgicn
gvgialaqaqfaatynkpdfpisdsytyvflgdgclmegvsseasslaghlqlgnliafw
ddnkisidgstevaftedviaryksygwhivevsdadtditaiaaaideakkvtnkptlv
rltttigfgslaqgthgvhgaplkaddikqlktkwgfnpeesfavpaevtasynehvaen
qkiqqqwnelfaaykqkypelgaelqrrldgk

SCOPe Domain Coordinates for d5xpsa1 are not available.

Timeline for d5xpsa1:

Domains from same chain:
(mouse over for more information)
d5xpsa2, d5xpsa3