Lineage for d5xtya1 (5xty A:45-270)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2404400Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2404401Protein automated matches [190388] (28 species)
    not a true protein
  7. 2404421Species Cocos nucifera [TaxId:13894] [340731] (2 PDB entries)
  8. 3053286Domain d5xtya1: 5xty A:45-270 [353348]
    automated match to d5wpwa1

Details for d5xtya1

PDB Entry: 5xty (more details), 2.2 Å

PDB Description: crystal structure of 11s allergen from cocos nucifera l.
PDB Compounds: (A:) 11S globulin isoform 1

SCOPe Domain Sequences for d5xtya1:

Sequence, based on SEQRES records: (download)

>d5xtya1 b.82.1.0 (A:45-270) automated matches {Cocos nucifera [TaxId: 13894]}
crierlnaleptrtvrseagvtdyfdedneqfrcagvstirrvieprglllpsmsnaprl
vyivqgrgivglvmpgcpetfqsfqrsereegerhrwsrdehqkvyqfqegdvlavpngf
aywcynngenpvvaitvldtsndanqldrshrqfllagrqeqgrqrygregsikenilrg
fstellaaafgvnmelarklqcrddtrgeivraenglqvlrpsgme

Sequence, based on observed residues (ATOM records): (download)

>d5xtya1 b.82.1.0 (A:45-270) automated matches {Cocos nucifera [TaxId: 13894]}
crierlnaleptrtvrseagvtdyfdedneqfrcagvstirrvieprglllpsmsnaprl
vyivqgrgivglvmpgcpetfrwsrdehqkvyqfqegdvlavpngfaywcynngenpvva
itvldtsndanqldrshrqfllagregsikenilrgfstellaaafgvnmerklqcrddt
rgeivraenglqvlrpsgme

SCOPe Domain Coordinates for d5xtya1:

Click to download the PDB-style file with coordinates for d5xtya1.
(The format of our PDB-style files is described here.)

Timeline for d5xtya1:

  • d5xtya1 appears in periodic updates to SCOPe 2.07 starting on 2018-06-07

View in 3D
Domains from same chain:
(mouse over for more information)
d5xtya2