Lineage for d5zk0a_ (5zk0 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. Protein automated matches [193326] (11 species)
    not a true protein
  7. Species Vibrio cholerae [TaxId:243277] [311867] (9 PDB entries)
  8. Domain d5zk0a_: 5zk0 A: [353343]
    automated match to d5h6fa_
    complexed with na; mutant

Details for d5zk0a_

PDB Entry: 5zk0 (more details), 2.55 Å

PDB Description: crystal structure of peptidyl-trna hydrolase mutant -m71a from vibrio cholerae
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d5zk0a_:

Sequence, based on SEQRES records: (download)

>d5zk0a_ c.56.3.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
mvsqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsq
elrvlipttfanlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghngl
kdtisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqexldaavdesvrcleilm
kdgltkaqnrlhtfkae

Sequence, based on observed residues (ATOM records): (download)

>d5zk0a_ c.56.3.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
mvsqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsq
elrvlipttfanlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghngl
kdtisklgnnkefyrlrlgighpkvagyvlgkapakeqexldaavdesvrcleilmkdgl
tkaqnrlhtfkae

SCOPe Domain Coordinates for d5zk0a_ are not available.

Timeline for d5zk0a_:

Domains from other chains:
(mouse over for more information)
d5zk0b_