Lineage for d5zk0b_ (5zk0 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2464564Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2465875Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2465889Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2465890Protein automated matches [193326] (11 species)
    not a true protein
  7. 2465949Species Vibrio cholerae [TaxId:243277] [311867] (10 PDB entries)
  8. 3053279Domain d5zk0b_: 5zk0 B: [353341]
    automated match to d5h6fa_
    complexed with na; mutant

Details for d5zk0b_

PDB Entry: 5zk0 (more details), 2.55 Å

PDB Description: crystal structure of peptidyl-trna hydrolase mutant -m71a from vibrio cholerae
PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d5zk0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zk0b_ c.56.3.0 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
mvsqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsq
elrvlipttfanlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghngl
kdtisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqexldaavdesvrcleilm
kdgltkaqnrlhtfkae

SCOPe Domain Coordinates for d5zk0b_:

Click to download the PDB-style file with coordinates for d5zk0b_.
(The format of our PDB-style files is described here.)

Timeline for d5zk0b_:

  • d5zk0b_ is new in SCOPe 2.07-stable