Lineage for d5y0ga1 (5y0g A:0-131)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395948Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2396280Protein automated matches [190295] (7 species)
    not a true protein
  7. 2396296Species Human (Homo sapiens) [TaxId:9606] [187133] (101 PDB entries)
  8. 3053272Domain d5y0ga1: 5y0g A:0-131 [353334]
    Other proteins in same PDB: d5y0ga2
    automated match to d5bvqa_
    complexed with 8jl

Details for d5y0ga1

PDB Entry: 5y0g (more details), 1.54 Å

PDB Description: crystal structure of human fabp4 complexed with ligand 4-fluoro-3-((4- methoxynaphthalene)-1-sulfonamido) benzoic acid
PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d5y0ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y0ga1 b.60.1.2 (A:0-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfkn
teisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvm
kgvtstrvyera

SCOPe Domain Coordinates for d5y0ga1:

Click to download the PDB-style file with coordinates for d5y0ga1.
(The format of our PDB-style files is described here.)

Timeline for d5y0ga1:

  • d5y0ga1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5y0ga2