Lineage for d5xlhl_ (5xlh L:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018743Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 3018744Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 3018745Family e.18.1.1: Nickel-iron hydrogenase, large subunit [56763] (2 proteins)
  6. 3018776Protein automated matches [190109] (8 species)
    not a true protein
  7. 3018876Species Desulfovibrio vulgaris [TaxId:883] [186833] (12 PDB entries)
  8. 3018888Domain d5xlhl_: 5xlh L: [353333]
    Other proteins in same PDB: d5xlhs_
    automated match to d4ud6r_
    complexed with f3s, mg, mpd, nfv, sf4

Details for d5xlhl_

PDB Entry: 5xlh (more details), 1.93 Å

PDB Description: crystal structure of aerobically purified and aerobically crystallized for 12weeks d. vulgaris miyazaki f [nife]-hydrogenase
PDB Compounds: (L:) Periplasmic [NiFe] hydrogenase Large subunit

SCOPe Domain Sequences for d5xlhl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xlhl_ e.18.1.1 (L:) automated matches {Desulfovibrio vulgaris [TaxId: 883]}
sysgpivvdpvtrieghlrievevengkvknayssstlfrgleiilkgrdprdaqhftqr
tcgvctythalastrcvdnavgvhipknatyirnlvlgaqylhdhivhfyhlhaldfvdv
taalkadpakaakvassisprkttaadlkavqdklktfvesgqlgpftnayflgghpayy
ldpetnliatahylealrlqvkaaramavfgaknphtqftvvggvtcydaltpqriaefe
alwketkafvdevyipdllvvaaaykdwtqyggtdnfitfgefpkdeydlnsrffkpgvv
fkrdfknikpfdkmqieehvrhswyegaearhpwkgqtqpkytdlhgddryswmkaprym
gepmetgplaqvliaysqghpkvkavtdavlaklgvgpealfstlgrtaargietaviae
yvgvmlqeykdniakgdnvicapwempkqaegvgfvnaprgglshwiriedgkignfqlv
vpstwtlgprcdknklspveasligtpvadakrpveilrtvhsfdpciacgvh

SCOPe Domain Coordinates for d5xlhl_:

Click to download the PDB-style file with coordinates for d5xlhl_.
(The format of our PDB-style files is described here.)

Timeline for d5xlhl_: