Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
Protein p53-binding protein 1, 53BP1, C-terminal domain [418915] (1 species) protein duplication: contains two Tudor domains in tandem |
Species Human (Homo sapiens) [TaxId:9606] [419339] (18 PDB entries) Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606 |
Domain d5z78c2: 5z78 C:1538-1603 [353325] Other proteins in same PDB: d5z78a1, d5z78a2, d5z78b_, d5z78c1, d5z78c3 automated match to d1ssfa2 protein/DNA complex |
PDB Entry: 5z78 (more details), 1.76 Å
SCOPe Domain Sequences for d5z78c2:
Sequence, based on SEQRES records: (download)
>d5z78c2 b.34.9.1 (C:1538-1603) p53-binding protein 1, 53BP1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr eqyglg
>d5z78c2 b.34.9.1 (C:1538-1603) p53-binding protein 1, 53BP1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ipldtevtalsedeyfsagvvkghrkesgelyysikegqrkwykrmavilsleqgnrlre qyglg
Timeline for d5z78c2: