Lineage for d5z78c2 (5z78 C:1538-1603)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784518Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. 2784552Protein p53-binding protein 1, 53BP1, C-terminal domain [418915] (1 species)
    protein duplication: contains two Tudor domains in tandem
  7. 2784553Species Human (Homo sapiens) [TaxId:9606] [419339] (18 PDB entries)
    Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606
  8. 2784563Domain d5z78c2: 5z78 C:1538-1603 [353325]
    Other proteins in same PDB: d5z78a1, d5z78a2, d5z78b_, d5z78c1, d5z78c3
    automated match to d1ssfa2
    protein/DNA complex

Details for d5z78c2

PDB Entry: 5z78 (more details), 1.76 Å

PDB Description: structure of tirr/53bp1 complex
PDB Compounds: (C:) TP53-binding protein 1

SCOPe Domain Sequences for d5z78c2:

Sequence, based on SEQRES records: (download)

>d5z78c2 b.34.9.1 (C:1538-1603) p53-binding protein 1, 53BP1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqyglg

Sequence, based on observed residues (ATOM records): (download)

>d5z78c2 b.34.9.1 (C:1538-1603) p53-binding protein 1, 53BP1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysikegqrkwykrmavilsleqgnrlre
qyglg

SCOPe Domain Coordinates for d5z78c2:

Click to download the PDB-style file with coordinates for d5z78c2.
(The format of our PDB-style files is described here.)

Timeline for d5z78c2: