Lineage for d5vzpa_ (5vzp A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. Protein Myoglobin [46469] (10 species)
  7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (316 PDB entries)
    Uniprot P02185
  8. Domain d5vzpa_: 5vzp A: [353317]
    automated match to d2mgga_
    complexed with gol, hem, no, no2, so4

Details for d5vzpa_

PDB Entry: 5vzp (more details), 1.7800000000000002 Å

PDB Description: sperm whale myoglobin h64q with nitric oxide
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d5vzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vzpa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkqgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gnfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d5vzpa_ are not available.

Timeline for d5vzpa_: