Lineage for d5xlgl_ (5xlg L:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573281Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2573282Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2573283Family e.18.1.1: Nickel-iron hydrogenase, large subunit [56763] (2 proteins)
  6. 2573314Protein automated matches [190109] (8 species)
    not a true protein
  7. 2573401Species Desulfovibrio vulgaris [TaxId:883] [186833] (12 PDB entries)
  8. 3053242Domain d5xlgl_: 5xlg L: [353304]
    Other proteins in same PDB: d5xlgs_
    automated match to d4ud6r_
    complexed with f3s, mg, mpd, nfv, sf4, trs

Details for d5xlgl_

PDB Entry: 5xlg (more details), 1.64 Å

PDB Description: crystal structure of anaerobically purified and aerobically crystallized d. vulgaris miyazaki f [nife]-hydrogenase
PDB Compounds: (L:) Periplasmic [NiFe] hydrogenase Large subunit

SCOPe Domain Sequences for d5xlgl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xlgl_ e.18.1.1 (L:) automated matches {Desulfovibrio vulgaris [TaxId: 883]}
ssysgpivvdpvtrieghlrievevengkvknayssstlfrgleiilkgrdprdaqhftq
rtcgvctythalastrcvdnavgvhipknatyirnlvlgaqylhdhivhfyhlhaldfvd
vtaalkadpakaakvassisprkttaadlkavqdklktfvesgqlgpftnayflgghpay
yldpetnliatahylealrlqvkaaramavfgaknphtqftvvggvtcydaltpqriaef
ealwketkafvdevyipdllvvaaaykdwtqyggtdnfitfgefpkdeydlnsrffkpgv
vfkrdfknikpfdkmqieehvrhswyegaearhpwkgqtqpkytdlhgddryswmkapry
mgepmetgplaqvliaysqghpkvkavtdavlaklgvgpealfstlgrtaargietavia
eyvgvmlqeykdniakgdnvicapwempkqaegvgfvnaprgglshwiriedgkignfql
vvpstwtlgprcdknklspveasligtpvadakrpveilrtvhsfdpciacgvh

SCOPe Domain Coordinates for d5xlgl_:

Click to download the PDB-style file with coordinates for d5xlgl_.
(The format of our PDB-style files is described here.)

Timeline for d5xlgl_:

  • d5xlgl_ is new in SCOPe 2.07-stable