Lineage for d6c4aa1 (6c4a A:1-427)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2423593Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2423788Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 proteins)
    forms a swapped dimer
  6. 2423812Protein Isocitrate lyase [51642] (4 species)
    elaborated with additional subdomains
  7. 2423831Species Mycobacterium tuberculosis [TaxId:652616] [322477] (3 PDB entries)
  8. 3053213Domain d6c4aa1: 6c4a A:1-427 [353275]
    Other proteins in same PDB: d6c4aa2
    automated match to d5dqla_
    complexed with 3np, epe, mg, peg, pyr

Details for d6c4aa1

PDB Entry: 6c4a (more details), 1.8 Å

PDB Description: crystal structure of 3-nitropropionate modified isocitrate lyase from mycobacterium tuberculosis with pyruvate
PDB Compounds: (A:) Isocitrate lyase 1

SCOPe Domain Sequences for d6c4aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c4aa1 c.1.12.7 (A:1-427) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 652616]}
msvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
wedqlasekkxghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
steegqf

SCOPe Domain Coordinates for d6c4aa1:

Click to download the PDB-style file with coordinates for d6c4aa1.
(The format of our PDB-style files is described here.)

Timeline for d6c4aa1:

  • d6c4aa1 appears in periodic updates to SCOPe 2.07 starting on 2018-06-07