Lineage for d5oyhd_ (5oyh D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954860Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2954861Protein automated matches [191274] (13 species)
    not a true protein
  7. 2954867Species Catenaria anguillulae [TaxId:765915] [353236] (2 PDB entries)
  8. 2954875Domain d5oyhd_: 5oyh D: [353272]
    automated match to d6ao9a_
    complexed with ca, gol, t99

Details for d5oyhd_

PDB Entry: 5oyh (more details), 2.25 Å

PDB Description: crystal structure of the catalytic core of a rhodopsin-guanylyl cyclase with converted specificity in complex with atpalphas
PDB Compounds: (D:) Nucleotide cyclase

SCOPe Domain Sequences for d5oyhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oyhd_ d.58.29.0 (D:) automated matches {Catenaria anguillulae [TaxId: 765915]}
mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
vtark

SCOPe Domain Coordinates for d5oyhd_:

Click to download the PDB-style file with coordinates for d5oyhd_.
(The format of our PDB-style files is described here.)

Timeline for d5oyhd_: