Lineage for d1tmoa2 (1tmo A:5-631)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140642Protein Trimethylamine N-oxide reductase [53713] (1 species)
  7. 2140643Species Shewanella massilia [TaxId:76854] [53714] (1 PDB entry)
  8. 2140644Domain d1tmoa2: 1tmo A:5-631 [35327]
    Other proteins in same PDB: d1tmoa1
    complexed with 2md, 2mo

Details for d1tmoa2

PDB Entry: 1tmo (more details), 2.5 Å

PDB Description: trimethylamine n-oxide reductase from shewanella massilia
PDB Compounds: (A:) trimethylamine n-oxide reductase

SCOPe Domain Sequences for d1tmoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmoa2 c.81.1.1 (A:5-631) Trimethylamine N-oxide reductase {Shewanella massilia [TaxId: 76854]}
nedewlttgshfgafkmkrkngviaevkpfdldkyptdmingirgmvynpsrvrypmvrl
dfllkghksnthqrgdfrfvrvtwdkaltlfkhsldevqtqygpsglhagqtgwratgql
hsstshmqravgmhgnyvkkigdystgagqtilpyvlgstevyaqgtswplilehsdtiv
lwsndpyknlqvgwnaethesfaylaqlkekvkqgkirvisidpvvtktqaylgceqlyv
npqtdvtlmlaiahemiskklyddkfiqgyslgfeefvpyvmgtkdgvaktpewaapicg
veahvirdlaktlvkgrtqfmmgwciqrqqhgeqpywmaavlatmigqiglpgggisygh
hyssigvpssgaaapgafprnldenqkplfdssdfkgasstipvarwidailepgktida
ngskvvypdikmmifsgnnpwnhhqdrnrmkqafhklecvvtvdvnwtatcrfsdivlpa
cttyerndidvygayanrgilamqkmveplfdslsdfeiftrfaavlgkekeytrnmgem
ewletlyneckaanagkfempdfatfwkqgyvhfgdgevwtrhadfrndpeinplgtpsg
lieifsrkidqfgyddckghptwmekt

SCOPe Domain Coordinates for d1tmoa2:

Click to download the PDB-style file with coordinates for d1tmoa2.
(The format of our PDB-style files is described here.)

Timeline for d1tmoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tmoa1