![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Factor D [50563] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50564] (29 PDB entries) |
![]() | Domain d6ftza_: 6ftz A: [353261] automated match to d1op8a_ complexed with e7e |
PDB Entry: 6ftz (more details), 1.67 Å
SCOPe Domain Sequences for d6ftza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ftza_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
Timeline for d6ftza_: