Lineage for d5w19c_ (5w19 C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2471247Family c.67.1.2: Beta-eliminating lyases [53397] (3 proteins)
  6. 2471248Protein Tryptophan indol-lyase (tryptophanase) [53400] (2 species)
  7. 2471261Species Proteus vulgaris [TaxId:585] [53401] (3 PDB entries)
  8. 3053198Domain d5w19c_: 5w19 C: [353260]
    automated match to d1ax4a_
    complexed with 9td, k

Details for d5w19c_

PDB Entry: 5w19 (more details), 2.1 Å

PDB Description: tryptophan indole-lyase complex with oxindolyl-l-alanine
PDB Compounds: (C:) tryptophanase

SCOPe Domain Sequences for d5w19c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w19c_ c.67.1.2 (C:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]}
akrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdhq
waamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegka
knpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhga
dnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpky
knatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvty
gglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdckk
lvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarrv
ytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpie

SCOPe Domain Coordinates for d5w19c_:

Click to download the PDB-style file with coordinates for d5w19c_.
(The format of our PDB-style files is described here.)

Timeline for d5w19c_:

  • d5w19c_ is new in SCOPe 2.07-stable