Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries) |
Domain d5mgtc1: 5mgt C:90-215 [353254] Other proteins in same PDB: d5mgtc2 automated match to d1xpha_ complexed with cl, nag, so4 |
PDB Entry: 5mgt (more details), 1.9 Å
SCOPe Domain Sequences for d5mgtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mgtc1 d.169.1.0 (C:90-215) automated matches {Human (Homo sapiens) [TaxId: 9606]} gllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdka ilfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwi cqkelt
Timeline for d5mgtc1: