Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) common fold is elaborated with additional secondary structures |
Family d.58.29.0: automated matches [191671] (1 protein) not a true family |
Protein automated matches [191274] (13 species) not a true protein |
Species Catenaria anguillulae [TaxId:765915] [353236] (2 PDB entries) |
Domain d5oyhc_: 5oyh C: [353237] automated match to d6ao9a_ complexed with ca, gol, t99 |
PDB Entry: 5oyh (more details), 2.25 Å
SCOPe Domain Sequences for d5oyhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oyhc_ d.58.29.0 (C:) automated matches {Catenaria anguillulae [TaxId: 765915]} teakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigda ylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdln phwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtywv tark
Timeline for d5oyhc_: