Lineage for d6d9yb1 (6d9y B:1-250)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. Protein automated matches [190069] (313 species)
    not a true protein
  7. Species Paraburkholderia phymatum [TaxId:391038] [333644] (2 PDB entries)
  8. Domain d6d9yb1: 6d9y B:1-250 [353231]
    Other proteins in same PDB: d6d9ya2, d6d9yb2
    automated match to d3cxta_
    complexed with edo, fmt, nad, oxm

Details for d6d9yb1

PDB Entry: 6d9y (more details), 1.3 Å

PDB Description: crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied nad
PDB Compounds: (B:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d6d9yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d9yb1 c.2.1.0 (B:1-250) automated matches {Paraburkholderia phymatum [TaxId: 391038]}
mnridlegrvvvitggargigyavaqralrsgaavalwdldaerlarserelaelgkvca
vtvdqtkeaqieaavgktlaafgaidvlincagitggngttwelepdvwrqvidvnligp
ylvcravvpqmlkqgygrivniasvagkegnpnashysaskagligltkslgkelatkni
lvnavtpaaakteifdsmkqehidymlskipmnrfllpdeaaslilwlgsedcafstgsv
fdlsggraty

SCOPe Domain Coordinates for d6d9yb1 are not available.

Timeline for d6d9yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6d9yb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6d9ya1, d6d9ya2