Lineage for d6cqnb2 (6cqn B:93-190)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2350049Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2350057Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 3053166Domain d6cqnb2: 6cqn B:93-190 [353228]
    Other proteins in same PDB: d6cqna1, d6cqna2, d6cqnb1, d6cqnd1, d6cqnd2, d6cqne1, d6cqne2
    automated match to d1sebb1
    complexed with cl, mg, nag, so4

Details for d6cqnb2

PDB Entry: 6cqn (more details), 2.5 Å

PDB Description: crystal structure of f5 tcr -dr11-rq13 peptide complex
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-11 beta chain

SCOPe Domain Sequences for d6cqnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cqnb2 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvhpkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeektgvvstglihngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d6cqnb2:

Click to download the PDB-style file with coordinates for d6cqnb2.
(The format of our PDB-style files is described here.)

Timeline for d6cqnb2:

  • d6cqnb2 appears in periodic updates to SCOPe 2.07 starting on 2018-06-07