Lineage for d6cqnb1 (6cqn B:1-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938377Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries)
  8. 2938391Domain d6cqnb1: 6cqn B:1-92 [353227]
    Other proteins in same PDB: d6cqna1, d6cqna2, d6cqna3, d6cqnb2, d6cqnd1, d6cqnd2, d6cqne1, d6cqne2
    automated match to d1klub2
    complexed with cl, mg, nag, so4

    fragment; missing more than one-third of the common structure and/or sequence

Details for d6cqnb1

PDB Entry: 6cqn (more details), 2.5 Å

PDB Description: crystal structure of f5 tcr -dr11-rq13 peptide complex
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-11 beta chain

SCOPe Domain Sequences for d6cqnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cqnb1 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
gdtrprfleystsechffngtervrfldryfynqeeyvrfdsdvgefravtelgrpdeey
wnsqkdfledrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d6cqnb1:

Click to download the PDB-style file with coordinates for d6cqnb1.
(The format of our PDB-style files is described here.)

Timeline for d6cqnb1: