Lineage for d6ftya_ (6fty A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. Protein Factor D [50563] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [50564] (29 PDB entries)
  8. Domain d6ftya_: 6fty A: [353221]
    automated match to d1op8a_
    complexed with e7h, gol

Details for d6ftya_

PDB Entry: 6fty (more details), 1.6700000000000002 Å

PDB Description: complement factor d complexed with compound 5
PDB Compounds: (A:) complement factor d

SCOPe Domain Sequences for d6ftya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ftya_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d6ftya_ are not available.

Timeline for d6ftya_: