Lineage for d6d62a_ (6d62 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2404335Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (2 proteins)
    Pfam PF06052; 3-HAO
  6. 2404351Protein automated matches [311561] (3 species)
    not a true protein
  7. 2404352Species Ralstonia metallidurans [TaxId:266264] [311562] (4 PDB entries)
  8. 3053149Domain d6d62a_: 6d62 A: [353211]
    automated match to d4wzca_
    complexed with 3ha, fe2, trs

Details for d6d62a_

PDB Entry: 6d62 (more details), 1.77 Å

PDB Description: crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase i142p from cupriavidus metallidurans in complex with 3-haa
PDB Compounds: (A:) 3-hydroxyanthranilate 3,4-dioxygenase

SCOPe Domain Sequences for d6d62a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d62a_ b.82.1.20 (A:) automated matches {Ralstonia metallidurans [TaxId: 266264]}
mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
fewycdacghlvhrvevqlkspvtdlpplfesfyasedkrrcphcgqvhpgraa

SCOPe Domain Coordinates for d6d62a_:

Click to download the PDB-style file with coordinates for d6d62a_.
(The format of our PDB-style files is described here.)

Timeline for d6d62a_:

  • d6d62a_ appears in periodic updates to SCOPe 2.07 starting on 2018-06-07